Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID148663405
StrainMtb_H37Ra
Protein IDYP_001284928.1
Description hypothetical protein MRA_3581 [Mycobacterium tuberculosis H37Ra]
Sequence MTGVSDIQEAVAQIKAAGPSKPRLARDPVNQPMINNWVEAIGDRNPIYVD
DAAARAAGHPGIVAPPAMIQVWTMMGLGGVRPKDDPLGPIIKLFDDAGYI
GVVATNCEQTYHRYLLPGEQVSISAELGDVVGPKQTALGEGWFINQHIVW
QVGDEDVAEMNWRILKFKPAGSPSSVPDDLDPDAMMRPSSSRDTAFFWDG
VKAHELRIQRLADGSLRHPPVPAVWQDKSVPINYVVSSGRGTVFSFVVHH
APKVPGRTVPFVIALVELEEGVRMLGELRGADPARVAIGMPVRATYIDFP
DWSLYAWEPDE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)30
MHC class II prediction (Propred)50
MHC class 1 prediction (Propred1)200
CTL epitope prediction (CTLpred)48
Prediction of interferon-gamma inducing peptides (IFNepitope)121
Prediction of IL4 inducing peptides (IL4pred)205