Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID148822507
StrainMtb_F11
Protein IDYP_001287261.1
Description hypothetical protein TBFG_11316 [Mycobacterium tuberculosis F11]
Sequence MLQRSLGVNGRKLAMSARSAKRERKNASTAASKCYVVPPSARGWVHAYSV
TATSMLNRRKAILDYLQGAVWVLPTFGVAIGLGSGAVLSMIPVKSGTLID
KLMFQGTPGDARGVLIVVSATMITTIGIVFSLTVLSLQIASSQFSVRLLR
TFLRDVPNQVVLAIFACTFAYSTGGLHTVGEHRDGGAFIPKVAVTGSLAL
AFVSIAALIYFLHHLMHSIQIDTIMDKVRLRTLGLVDQLYPESDTADRQV
ETPPSPPADAVPLLAPHSGYLQTVDVDDIAELAAASRYTALLVTFVGDYV
TAGGLLGWCWRRGTAPGAPGSDFPQRCLRHVHIGFERTLQQDIRFGLRQM
VDIALRALSPALNDPYTAIQVVHHLSAVESVLASRALPDDVRRDRAGELL
FWLPYPSFATYLHVGCAQIRRYGSREPLVLTALLQLLSAVAQNCVDPSRR
VAVQTQIALVVRAAQREFADESDRAMVLGAAARATEVVERPGTLAPPPST
FGQVAAAQAAASTIRSADRDG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)33
MHC class II prediction (Propred)107
MHC class 1 prediction (Propred1)370
CTL epitope prediction (CTLpred)99
Prediction of interferon-gamma inducing peptides (IFNepitope)213
Prediction of IL4 inducing peptides (IL4pred)321