Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID148823026
StrainMtb_F11
Protein IDYP_001287780.1
Description hypothetical protein TBFG_11843 [Mycobacterium tuberculosis F11]
Sequence MITNLRRRTAMAAAGLGAALGLGILLVPTVDAHLANGSMSEVMMSEIAGL
PIPPIIHYGAIAYAPSGASGKAWHQRTPARAEQVALEKCGDKTCKVVSRF
TRCGAVAYNGSKYQGGTGLTRRAAEDDAVNRLEGGRIVNWACN
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)19
MHC class II prediction (Propred)18
MHC class 1 prediction (Propred1)96
CTL epitope prediction (CTLpred)21
Prediction of interferon-gamma inducing peptides (IFNepitope)75
Prediction of IL4 inducing peptides (IL4pred)87