Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID148823068
StrainMtb_F11
Protein IDYP_001287822.1
Description molybdate-binding lipoprotein modA [Mycobacterium tuberculosis F11]
Sequence MRWIGLSTGLVSAMLVAGLVACGSNSPASSPAGPTQGARSIVVFAAASLQ
SAFTQIGEQFKAGNPGVNVNFAFAGSSELATQLTQGATADVFASADTAQM
DSVAKAGLLAGHPTNFATNTMVIVAAAGNPKKIRSFADLTRPGLNVVVCQ
PSVPCGSATRRIEDATGIHLNPVSEELSVTDVLNKVITGQADAGLVYVSD
ALSVATKVTCVRFPEAAGVVNVYAIAVLKRTSQPALARQFVAMVTAAAGR
RILDQSGFAKP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)21
MHC class II prediction (Propred)42
MHC class 1 prediction (Propred1)166
CTL epitope prediction (CTLpred)41
Prediction of interferon-gamma inducing peptides (IFNepitope)111
Prediction of IL4 inducing peptides (IL4pred)166