Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID148823083
StrainMtb_F11
Protein IDYP_001287837.1
Description L-lactate dehydrogenase (cytochrome) lldD2 [Mycobacterium tuberculo
Sequence MAVNRRVPRVRDLAPLLQFNRPQFDTSKRRLGAALTIQDLRRIAKRRTPR
AAFDYADGGAEDELSIARARQGFRDIEFHPTILRDVTTVCAGWNVLGQPT
VLPFGIAPTGFTRLMHTEGEIAGARAAAAAGIPFSLSTLATCAIEDLVIA
VPQGRKWFQLYMWRDRDRSMALVRRVAAAGFDTMLVTVDVPVAGARLRDV
RNGMSIPPALTLRTVLDAMGHPRWWFDLLTTEPLAFASLDRWPGTVGEYL
NTVFDPSLTFDDLAWIKSQWPGKLVVKGIQTLDDARAVVDRGVDGIVLSN
HGGRQLDRAPVPFHLLPHVARELGKHTEILVDTGIMSGADIVAAIALGAR
CTLIGRAYLYGLMAGGEAGVNRAIEILQTGVIRTMRLLGVTCLEELSPRH
VTQLRRLGPIGAPT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)34
MHC class II prediction (Propred)72
MHC class 1 prediction (Propred1)296
CTL epitope prediction (CTLpred)78
Prediction of interferon-gamma inducing peptides (IFNepitope)173
Prediction of IL4 inducing peptides (IL4pred)224