Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID148823849
StrainMtb_F11
Protein IDYP_001288603.1
Description phiRv2 prophage protein [Mycobacterium tuberculosis F11]
Sequence MADAVKYVVMCNCDDEPGALIIAWIDDERPAGGHIQMRSNTRFTETQWGR
HIEWKLECRACRKYAPISEMTAAAILDGFGAKLHELRTSTIPDADDPSIA
EARHVIPFSALCLRLSQLGG
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)7
MHC class II prediction (Propred)14
MHC class 1 prediction (Propred1)72
CTL epitope prediction (CTLpred)17
Prediction of interferon-gamma inducing peptides (IFNepitope)53
Prediction of IL4 inducing peptides (IL4pred)84