Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
gene ID | 148825073 |
Strain | Mtb_F11 |
Protein ID | YP_001289827.1 |
Description | hypothetical protein TBFG_13900 [Mycobacterium tuberculosis F11] |
Sequence | MTGFLGVVPSFLKVLAGMHNEIVDDIKRATDTVAGISGRVQLTHGSFTSK FNDTLQEFETTRSSTGTGLQGVTSGLANNLLAAAGAYLKADDGLAGVIDK IFG |
B cell epitope (IEDB) | 0 |
T cell epitope (IEDB) | 11 |
MHC binder (IEDB) | 0 |
Vaccine Target | Yes |
B cell prediction (LBtope) | 6 |
MHC class II prediction (Propred) | 28 |
MHC class 1 prediction (Propred1) | 120 |
CTL epitope prediction (CTLpred) | 14 |
Prediction of interferon-gamma inducing peptides (IFNepitope) | 64 |
Prediction of IL4 inducing peptides (IL4pred) | 105 |