Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID148825073
StrainMtb_F11
Protein IDYP_001289827.1
Description hypothetical protein TBFG_13900 [Mycobacterium tuberculosis F11]
Sequence MTGFLGVVPSFLKVLAGMHNEIVDDIKRATDTVAGISGRVQLTHGSFTSK
FNDTLQEFETTRSSTGTGLQGVTSGLANNLLAAAGAYLKADDGLAGVIDK
IFG
B cell epitope (IEDB)0
T cell epitope (IEDB)11
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)6
MHC class II prediction (Propred)28
MHC class 1 prediction (Propred1)120
CTL epitope prediction (CTLpred)14
Prediction of interferon-gamma inducing peptides (IFNepitope)64
Prediction of IL4 inducing peptides (IL4pred)105