Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15607392
StrainMtb_H37Rv
Protein IDNP_214765.1
Description hsp gene product [Mycobacterium tuberculosis H37Rv]
Sequence MNNLALWSRPVWDVEPWDRWLRDFFGPAATTDWYRPVAGDFTPAAEIVKD
GDDAVVRLELPGIDVDKDVNVELDPGQPVSRLVIRGEHRDEHTQDAGDKD
GRTLREIRYGSFRRSFRLPAHVTSEAIAASYDAGVLTVRVAGAYKAPAET
QAQRIAITK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)11
MHC class II prediction (Propred)21
MHC class 1 prediction (Propred1)104
CTL epitope prediction (CTLpred)23
Prediction of interferon-gamma inducing peptides (IFNepitope)75
Prediction of IL4 inducing peptides (IL4pred)131