Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
gene ID | 15608721 |
Strain | Mtb_H37Rv |
Protein ID | NP_216099.1 |
Description | unnamed protein product [Mycobacterium tuberculosis H37Rv] |
Sequence | MTAGAGGSPPTRRCPATEDRAPATVATPSSADPTASRAVSWWSVHEHVAP VLDAAGSWPMAGTPAWRQLDDADPRKWAAICDAARHWALRVETCQEAMAQ ASRDVSAAADWPGIAREIVRRRGVYIPRAGVA |
B cell epitope (IEDB) | 0 |
T cell epitope (IEDB) | 0 |
MHC binder (IEDB) | 0 |
Vaccine Target | Yes |
B cell prediction (LBtope) | 20 |
MHC class II prediction (Propred) | 5 |
MHC class 1 prediction (Propred1) | 75 |
CTL epitope prediction (CTLpred) | 21 |
Prediction of interferon-gamma inducing peptides (IFNepitope) | 54 |
Prediction of IL4 inducing peptides (IL4pred) | 92 |