Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15609073
StrainMtb_H37Rv
Protein IDNP_216452.1
Description unnamed protein product [Mycobacterium tuberculosis H37Rv]
Sequence MEIGIFLMPAHPPERTLYDATRWDLDVIELADQLGYVEAWVGEHFTVPWE
PICAPDLLLAQALLRTQQIKLAPGAHLLPYHHPVELAHRVAYFDHLAQGR
FMLGVGASGIPGDWALYDVDGKNGEHREMTREALEIMLRIWTEDEPWEHR
GKYWNANGIAPMFEGLMRRHIKPYQKPHPPIGVTGFSAGSETLKLAGERG
YIPMSLDLNTEYVATHWDAVEEGALRSGRTPDRRDWRLVREVLVAETDEQ
AFRYAVDGTMGRAMREYVLPTFRMFGMTKFYKHNPSVPDDEVTPEYLAEN
TFVVGSVQTVVDKLEATYDQVGGFGHLLILGFDYSDNPGPWKESLRLLAH
EVMPRLNARLATKPATAVV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)12
MHC class II prediction (Propred)56
MHC class 1 prediction (Propred1)243
CTL epitope prediction (CTLpred)60
Prediction of interferon-gamma inducing peptides (IFNepitope)158
Prediction of IL4 inducing peptides (IL4pred)238