Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15610269
StrainMtb_H37Rv
Protein IDNP_217649.1
Description devR gene product [Mycobacterium tuberculosis H37Rv]
Sequence MVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDV
AVLDVRLPDGNGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASG
YVVKDIKGMELARAVKDVGAGRSLLDNRAAAALMAKLRGAAEKQDPLSGL
TDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQA
AVFATELKRSRPPGDGP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)26
MHC class 1 prediction (Propred1)149
CTL epitope prediction (CTLpred)35
Prediction of interferon-gamma inducing peptides (IFNepitope)98
Prediction of IL4 inducing peptides (IL4pred)128