Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15610437
StrainMtb_H37Rv
Protein IDNP_217818.1
Description phoY1 gene product [Mycobacterium tuberculosis H37Rv]
Sequence MRTVYHQRLTELAGRLGEMCSLAGIAMKRATQALLEADIGAAEQVIRDHE
RIVAMRAQVEKEAFALLALQHPVAGELREIFSAVQIIADTERMGALAVHI
AKITRREYPNQVLPEEVRNCFADMAKVAIALGDSARQVLVNRDPQEAAQL
HDRDDAMDDLHRHLLSVLIDREWRHGVRVGVETALLGRFFERFADHAVEV
GRRVIFMVTGVLPTEDEISTY
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo