Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15610865
StrainMtb_H37Rv
Protein IDNP_218246.1
Description unnamed protein product [Mycobacterium tuberculosis H37Rv]
Sequence MFVEYTKSICPVCKVVVDAQVNIRHDKVYLRKRCREHGSFEALVYGDAQM
YLESARFNKPGTFPLRFQTEVRDGCPSDCGLCPDHKQHACLGLIEVNTHC
NLDCPICFADSGHQPDGYAITAAQCERMLDTLVAAEGEPEVVMFSGGEPT
IHKQLLEFVDAAQARPVKTVIINTNGIRLASDRRFVDQLATRNRPGHPVH
IYLQFDGLDEATHRRIRGHDLRDVKQRALDNCAAAGLTVSLVAAVERGLN
EHELGAVIRHGMAQPGVQPVVFQPVTHAGRHVQFDPLTRLTNSDIIACIT
AQLPEWFRPGDFFPVPCCFPSCRSITYLLTDGEHVVPIPRLLNVEDYLDY
VSNRVIPDLAIREALENLWSASAVPGTDTMTAQLQRATAALNCAEGCGIN
LPEALTHLTDRVFAIVIQDFQDPYTLNVKQLMKCCVQQITPDGRLIPFCA
YNSVGYREQVREQLTGVPVPDIVPNAIPLAGLLADAPHGSKQANTGGSIA
RLAGPTRGAPMALPPQQIKACCADAYSRDIVALLLGDSFHPGGATLTRRL
ADQLGLRSTGDPRRVADIAAGPGASARLLASDYGVAVDGVDISEINVKRA
QAAVAQTGLTERVRFHLGDAESVPLPDDTFDALVCECAFCTFPDKNAAAQ
QFARILRPGGLAGITDVTVGDGGLPAELTPLAAWVACIADARTVTDYTDI
LEGAGLRTRHIESHDESLLDMIDRIDARITALHVAAPEILADNGIRHDSV
RDFTALARAAVQTGRIGYTLMIAEKP
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)0
Vaccine TargetNo