Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15841607
StrainMtb_CDC_1551
Protein IDNP_336644.1
Description ATPase AAA [Mycobacterium tuberculosis CDC1551]
Sequence MGESERSEAFGIPRDSPLSSGDAAELEQLRREAAVLREQLENAVGSHAPT
RSARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQPPSG
YGVLLATHDDDTVDVFTSGRKMRLTCSPNIDAASLKKGQTVRLNEALTVV
EAGTFEAVGEISTLREILADGHRALVVGHADEERVVWLADPLIAEDLPDG
LPEALNDDTRPRKLRPGDSLLVDTKAGYAFERIPKAEVEDLVLEEVPDVS
YADIGGLSRQIEQIRDAVELPFLHKELYREYSLRPPKGVLLYGPPGCGKT
LIAKAVANSLAKKMAEVRGDDAHEAKSYFLNIKGPELLNKFVGETERHIR
LIFQRAREKASEGTPVIVFFDEMDSIFRTRGTGVSSDVETTVVPQLLSEI
DGVEGLENVIVIGASNREDMIDPAILRPGRLDVKIKIERPDAEAAQDIYS
KYLTEFLPVHADDLAEFDGDRSACIKAMIEKVVDRMYAEIDDNRFLEVTY
ANGDKEVMYFKDFNSGAMIQNVVDRAKKNAIKSVLETGQPGLRIQHLLDS
IVDEFAENEDLPNTTNPDDWARISGKKGERIVYIRTLVTGKSSSASRAID
TESNLGQYL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)52
MHC class II prediction (Propred)74
MHC class 1 prediction (Propred1)401
CTL epitope prediction (CTLpred)103
Prediction of interferon-gamma inducing peptides (IFNepitope)197
Prediction of IL4 inducing peptides (IL4pred)412