Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15843502
StrainMtb_CDC_1551
Protein IDNP_338539.1
Description hypothetical protein MT3985 [Mycobacterium tuberculosis CDC1551]
Sequence MTAEPEVRTLREVVLDQLGTAESRAYKMWLPPLTNPVPLNELIARDRRQP
LRFALGIMDEPRRHLQDVWGVDVSGAGGNIGIGGAPQTGKSTLLQTMVMS
AAATHSPRNVQFYCIDLGGGGLIYLENLPHVGGVANRSEPDKVNRVVAEM
QAVMRQRETTFKEHRVGSIGMYRQLRDDPSQPVASDPYGDVFLIIDGWPG
FVGEFPDLEGQVQDLAAQGLAFGVHVIISTPRWTELKSRVRDYLGTKIEF
RLGDVNETQIDRITREIPANRPGRAVSMEKHHLMIGVPRFDGVHSADNLV
EAITAGVTQIASQHTEQAPPVRVLPERIHLHELDPNPPGPESDYRTRWEI
PIGLRETDLTPAHCHMHTNPHLLIFGAAKSGKTTIAHAIARAICARNSPQ
QVRFMLADYRSGLLDAVPDTHLLGAGAINRNSASLDEAVQALAVNLKKRL
PPTDLTTAQLRSRSWWSGFDVVLLVDDWHMIVGAAGGMPPMAPLAPLLPA
AADIGLHIIVTCQMSQAYKATMDKFVGAAFGSGAPTMFLSGEKQEFPSSE
FKVKRRPPGQAFLVSPDGKEVIQAPYIEPPEEVFAAPPSAG
B cell epitope (IEDB)0
T cell epitope (IEDB)2
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)55
MHC class II prediction (Propred)78
MHC class 1 prediction (Propred1)395
CTL epitope prediction (CTLpred)89
Prediction of interferon-gamma inducing peptides (IFNepitope)207
Prediction of IL4 inducing peptides (IL4pred)371