Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID183983082
StrainM_marinum
Protein IDYP_001851373.1
Description hypothetical protein MMAR_3083 [Mycobacterium marinum M]
Sequence MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRN
GARLYLDVGSHPEYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADE
GIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQL
ICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADA
EKYRRLHVIVGDSNMCETTTMLKVGTASLVLEMIEAGVPFRDFSLDNPIR
AIREVSHDVTGRRPVRLAGGRQASALDIQREYYSRAVEHLQTREPNAQVE
QVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYNMELSDPKI
AQLDLAYHDIKRGRGVFDLLQRKGLATRVTTDEEIADAVDNPPQTTRARL
RGEFISAAQAAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIA
SM
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)25
MHC class II prediction (Propred)61
MHC class 1 prediction (Propred1)324
CTL epitope prediction (CTLpred)79
Prediction of interferon-gamma inducing peptides (IFNepitope)184
Prediction of IL4 inducing peptides (IL4pred)307