Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 183985420 |
| Strain | M_marinum |
| Protein ID | YP_001853711.1 |
| Description | Esat-6 like protein EsxB [Mycobacterium marinum M] |
| Sequence | MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQAQWRGAAGTA AQAAVVRFQEAANKQKAELDEISTNIRQAGVQYSRADDEQQQALSSQMGF |
| B cell epitope (IEDB) | 15 |
| T cell epitope (IEDB) | 162 |
| MHC binder (IEDB) | 234 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 18 |
| MHC class II prediction (Propred) | 27 |
| MHC class 1 prediction (Propred1) | 169 |
| CTL epitope prediction (CTLpred) | 18 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 90 |
| Prediction of IL4 inducing peptides (IL4pred) | 202 |