Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID224990356
StrainM_bovis_BCG_str_Tokyo_172
Protein IDYP_002645043.1
Description permease [Mycobacterium bovis BCG str. Tokyo 172]
Sequence MVGPRTRGYAIHKLGFCSVVMLGINSIIGAGIFLTPGEVIGLAGPFAPMA
YVLAGIFAGVVAIVFATAARYVRTNGASYAYTTAAFGRRIGIYVGVTHAI
TASIAWGVLASFFVSTLLRVAFPDKAWADAEQLFSVKTLTFLGFIGVLLA
INLFGNRAIKWANGTSTVGKAFALSAFIVGGLWIITTQHVNNYATAWSAY
SATPYSLLGVAEIGKGTFSSMALATIVALYAFTGFESIANAAEEMDAPDR
NLPRAIPIAIFSVGAIYLLTLTVAMLLGSNKIAASGDTVKLAAAIGNATF
RTIIVVGALISMFGINVAASFGAPRLWTALADSGVLPTRLSRKNQYDVPM
VSFAITASLALAFPLALRFDNLHLTGLAVIARFVQFIIVPIALIALARSQ
AVEHAAVRRNAFTDKVLPLVAIVVSVGLAVSYDYRCIFLVRGGPNYFSIA
LIVITFIVVPAMAYLHYYRIIRRVGDRPSTR
B cell epitope (IEDB)3
T cell epitope (IEDB)6
MHC binder (IEDB)14
Vaccine TargetYes
B cell prediction (LBtope)31
MHC class II prediction (Propred)131
MHC class 1 prediction (Propred1)379
CTL epitope prediction (CTLpred)116
Prediction of interferon-gamma inducing peptides (IFNepitope)173
Prediction of IL4 inducing peptides (IL4pred)295