Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID224992076
StrainM_bovis_BCG_str_Tokyo_172
Protein IDYP_002646765.1
Description periplasmic dipeptide-binding lipoprotein [Mycobacterium bovis BCG
Sequence MVRRMRAALAALATGLLVLAPVAGCGGGVLSPDVVLVNGGEPPNPLIPTG
TNDSNGGRIIDRLFAGLMSYDAVGKPSLEVAQSIESADNVNYRITVKPGW
KFTDGSPVTAHSFVDAWNYGALSTNAQLQQHFFSPIEGFDDVAGAPGDKS
RTTMSGLRVVNDLEFTVRLKAPTIDFTLRLGHSSFYPLPDSAFRDMAAFG
RNPIGNGPYKLADGPAGPAWEHNVRIDLVPNPDYHGNRKPRNKGLRFEFY
ANLDTAYADLLSGNLDVLDTIPPSALTVYQRDLGDHATSGPAAINQTLDT
PLRLPHFGGEEGRLRRLALSAAINRPQICQQIFAGTRSPARDFTARSLPG
FDPNLPGNEVLDYDPQRARRLWAQADAISPWSGRYAIAYNADAGHRDWVD
AVANSIKNVLGIDAVAAPQPTFAGFRTQITNRAIDSAFRAGWQGDYPSMI
EFLAPLFTAGAGSNDVGYINPEFDAALAAAEAAPTLTESHELVNDAQRIL
FHDMPVVPLWDYISVVGWSSQVSNVTVTWNGLPDYENIVKA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)21
MHC class II prediction (Propred)69
MHC class 1 prediction (Propred1)359
CTL epitope prediction (CTLpred)75
Prediction of interferon-gamma inducing peptides (IFNepitope)217
Prediction of IL4 inducing peptides (IL4pred)384