Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID224992222
StrainM_bovis_BCG_str_Tokyo_172
Protein IDYP_002646912.1
Description exported repetitive protein precursor [Mycobacterium bovis BCG str.
Sequence MPNRRRRKLSTAMSAVAALAVASPCAYFLVYESTETTERPEHHEFKQAAV
LTDLPGELMSALSQGLSQFGINIPPVPSLTGSGDASTGLTGPGLTSPGLT
SPGLTSPGLTDPALTSPGLTPTLPGSLAAPGTTLAPTPGVGANPALTNPA
LTSPTGATPGLTSPTGLDPALGGANEIPITTPVGLDPGADGTYPILGDPT
LGTIPSSPATTSTGGGGLVNDVMQVANELGASQAIDLLKGVLMPSIMQAV
QNGGAAAPAASPPVPPIPAAAAVPPTDPITVPVA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)15
MHC class II prediction (Propred)21
MHC class 1 prediction (Propred1)148
CTL epitope prediction (CTLpred)26
Prediction of interferon-gamma inducing peptides (IFNepitope)113
Prediction of IL4 inducing peptides (IL4pred)144