Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 224992330 |
| Strain | M_bovis_BCG_str_Tokyo_172 |
| Protein ID | YP_002647020.1 |
| Description | 50S ribosomal protein L34 [Mycobacterium bovis BCG str. Tokyo 172] |
| Sequence | MTKGKRTFQPNNRRRARVHGFRLRMRTRAGRSIVSSRRRKGRRTLSA |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 0 |
| MHC binder (IEDB) | 0 |
| Vaccine Target | No |