Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 240168354 |
| Strain | M_kansasii_ATCC_12478 |
| Protein ID | ZP_04747013.1 |
| Description | 6 kDa early secretory antigenic target esxA (Esat-6) [Mycobacterium |
| Sequence | MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEA YQGVQQKWDATAQELNNALQNLSRTISEAGQAMASTEGNVTGMFA |
| B cell epitope (IEDB) | 25 |
| T cell epitope (IEDB) | 243 |
| MHC binder (IEDB) | 264 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 63 |
| MHC class II prediction (Propred) | 16 |
| MHC class 1 prediction (Propred1) | 114 |
| CTL epitope prediction (CTLpred) | 16 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 96 |
| Prediction of IL4 inducing peptides (IL4pred) | 143 |