Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
gene ID | 240168354 |
Strain | M_kansasii_ATCC_12478 |
Protein ID | ZP_04747013.1 |
Description | 6 kDa early secretory antigenic target esxA (Esat-6) [Mycobacterium |
Sequence | MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEA YQGVQQKWDATAQELNNALQNLSRTISEAGQAMASTEGNVTGMFA |
B cell epitope (IEDB) | 25 |
T cell epitope (IEDB) | 243 |
MHC binder (IEDB) | 264 |
Vaccine Target | Yes |
B cell prediction (LBtope) | 63 |
MHC class II prediction (Propred) | 16 |
MHC class 1 prediction (Propred1) | 114 |
CTL epitope prediction (CTLpred) | 16 |
Prediction of interferon-gamma inducing peptides (IFNepitope) | 96 |
Prediction of IL4 inducing peptides (IL4pred) | 143 |