Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID253797818
StrainMtb_KZN_1435
Protein IDYP_003030819.1
Description araC/xylS-family virulence-regulating transcriptional regulator vir
Sequence MMELGSLIRATNLWGYTDLMRELGADPLPFLRRFDIPPGIEHQEDAFMSL
AGFVRMLEASAAELDCPDFGLRLARWQGLGILGPVAVIARNAATLFGGLE
AIGRYLYVHSPALTLTVSSTTARSNVRFGYEVTEPGIPYPLQGYELSMAN
AARMIRLLGGPQARARVFSFRHAQLGTDAAYREALGCTVRFGRTWCGFEV
DHRLAGRPIDHADPETKRIATKYLESQYLPSDATLSERVVGLARRLLPTG
QCSAEAIADQLDMHPRTLQRRLAAEGLRCHDLIERERRAQAARYLAQPGL
YLSQIAVLLGYSEQSALNRSCRRWFGMTPRQYRAYGGVSGR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)5
Vaccine TargetYes
B cell prediction (LBtope)27
MHC class II prediction (Propred)59
MHC class 1 prediction (Propred1)250
CTL epitope prediction (CTLpred)60
Prediction of interferon-gamma inducing peptides (IFNepitope)131
Prediction of IL4 inducing peptides (IL4pred)237