Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID253797887
StrainMtb_KZN_1435
Protein IDYP_003030888.1
Description PPE family protein [Mycobacterium tuberculosis KZN 1435]
Sequence MTAPVWLASPPEVHSALLSAGPGPGSLQAAAAGWSALSAEYAAVAQELSV
VVAAVGAGVWQGPSAELFVAAYVPYVAWLVQASADSAAAAGEHEAAAAGY
VCALAEMPTLPELAANHLTHAVLVATNFFGINTIPIALNEADYVRMWVQA
ATVMSAYEAVVGAALVATPHTGPAPVIVKPGANEASNAVAAATITPFPWH
EIVQFLEETFAAYDQYLSALLSELPAVAWVWFQLFVDILGFNIIGFIITL
ASNAQLLTEFAINASYVAVGLLYAIAGVIDIVVEWVIGNLFGVVPLLGGP
LLGALAAAVVPGVAGLAGVAGLAALPAVGAAAGAPAALVGSVAPVSGGVV
SPQARLVSAVEPAPASTSVSVLASDRGAGALGFVGTAGKESVGQPAGLTV
LADEFGDGAPVPMLPGSWGPDLVGVAGDGGLVSV
B cell epitope (IEDB)0
T cell epitope (IEDB)26
MHC binder (IEDB)3
Vaccine TargetYes
B cell prediction (LBtope)7
MHC class II prediction (Propred)70
MHC class 1 prediction (Propred1)300
CTL epitope prediction (CTLpred)75
Prediction of interferon-gamma inducing peptides (IFNepitope)220
Prediction of IL4 inducing peptides (IL4pred)240