Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID253799604
StrainMtb_KZN_1435
Protein IDYP_003032605.1
Description drugs-transport transmembrane ATP-binding protein ABC transporter [
Sequence MARGLQGVMLRSFGARDHTATVIETISIAPHFVRVRMVSPTLFQDAEAEP
AAWLRFWFPDPNGSNTEFQRAYTISEADPAAGRFAVDVVLHDPAGPASSW
ARTVKPGATIAVMSLMGSSRFDVPEEQPAGYLLIGDSASIPGMNGIIETV
PNDVPIEMYLEQHDDNDTLIPLAKHPRLRVRWVMRRDEKSLAEAIENRDW
SDWYAWATPEAAALKCVRVRLRDEFGFPKSEIHAQAYWNAGRAMGTHRAT
EPAATEPEVGAAPQPESAVPAPARGSWRAQAASRLLAPLKLPLVLSGVLA
ALVTLAQLAPFVLLVELSRLLVSGAGAHRLFTVGFAAVGLLGTGALLAAA
LTLWLHVIDARFARALRLRLLSKLSRLPLGWFTSRGSGSIKKLVTDDTLA
LHYLVTHAVPDAVAAVVAPVGVLVYLFVVDWRVALVLFGPVLVYLTITSS
LTIQSGPRIVQAQRWAEKMNGEAGSYLEGQPVIRVFGAASSSFRRRLDEY
IGFLVAWQRPLAGKKTLMDLATRPATFLWLIAATGTLLVATHRMDPVNLL
PFMFLGTTFGARLLGIAYGLGGLRTGLLAARHLQVTLDETELAVREHPRE
PLDGEAPATVVFDHVTFGYRPGVPVIQDVSLTLRPGTVTALVGPSGSGKS
TLATLLARFHDVERGAIRVGGQDIRSLAADELYTRVGFVLQEAQLVHGTA
AENIALAVPDAPAEQVQVAAREAQIHDRVLRLPDGYDTVLGANSGLSGGE
RQRLTIARAILGDTPVLILDEATAFADPESEYLVQQALNRLTRDRTVLVI
AHRLHTITRADQIVVLDHGRIVERGTHEELLAAGGRYCRLWDTGQGSRVA
VAAAQDGTR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)51
MHC class II prediction (Propred)152
MHC class 1 prediction (Propred1)610
CTL epitope prediction (CTLpred)166
Prediction of interferon-gamma inducing peptides (IFNepitope)401
Prediction of IL4 inducing peptides (IL4pred)530