Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID253800451
StrainMtb_KZN_1435
Protein IDYP_003033452.1
Description hypothetical protein TBMG_03455 [Mycobacterium tuberculosis KZN 143
Sequence MTILILTDNVHAHALAVDLQARHGDMDVYQSPIGQLPGVPRCDVAERVAE
IVERYDLVLSFHCKQRFPAALIDGVRCVNVHPGFNPYNRGWFPQVFSIID
GQKVGVTIHEIDDQLDHGPIIAQRECAIESWDSSGSVYARLMDIERELVL
EHFDAIRDGSYTAKSPATEGNLNLKKDFEQLRRLDLNERGTFGHFLNRLR
ALTHDDFRNAWFVDASGRKVFVRVVLEPEKPAEA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)20
MHC class II prediction (Propred)40
MHC class 1 prediction (Propred1)151
CTL epitope prediction (CTLpred)48
Prediction of interferon-gamma inducing peptides (IFNepitope)74
Prediction of IL4 inducing peptides (IL4pred)195