Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID253800586
StrainMtb_KZN_1435
Protein IDYP_003033587.1
Description cytochrome P450 125 cyp125 [Mycobacterium tuberculosis KZN 1435]
Sequence MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAA
PIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRF
KNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQER
AQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEM
TGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDG
EKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPE
TAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEV
FQDPFTFNTLRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPD
LKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)39
MHC class II prediction (Propred)60
MHC class 1 prediction (Propred1)292
CTL epitope prediction (CTLpred)62
Prediction of interferon-gamma inducing peptides (IFNepitope)190
Prediction of IL4 inducing peptides (IL4pred)327