Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 253800900 |
| Strain | Mtb_KZN_1435 |
| Protein ID | YP_003033902.1 |
| Description | hypothetical protein TBMG_03898 [Mycobacterium tuberculosis KZN 143 |
| Sequence | MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS GNRTNPSGATMAALANFFRIKAAYFTDDEYYEKLDKELQWLCTMRDDGVR RIAQRAHGLPSAAQQKVLDRIDELRRAEGIDA |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 0 |
| MHC binder (IEDB) | 0 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 11 |
| MHC class II prediction (Propred) | 15 |
| MHC class 1 prediction (Propred1) | 88 |
| CTL epitope prediction (CTLpred) | 23 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 47 |
| Prediction of IL4 inducing peptides (IL4pred) | 59 |