Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297636564
StrainMtb_KZN_4207
Protein IDZP_06954344.1
Description hypothetical protein MtubK4_20665 [Mycobacterium tuberculosis KZN 42
Sequence MAEPLAVDPTGLSAAAAKLAGLVFPQPPAPIAVSGTDSVVAAINETMPSI
ESLVSDGLPGVKAALTRTASNMNAAADVYAKTDQSLGTSLSQYAFGSSGE
GLAGVASVGGQPSQATQLLSTPVSQVTTQLGETAAELAPRVVATVPQLVQ
LAPHAVQMSQNASPIAQTISQTAQQAAQSAQGGSGPMPAQLASAEKPATE
QAEPVHEVTNDDQGDQGDVQPAEVVAAARDEGAGASPGQQPGGGVPAQAM
DTGAGARPAASPLAAPVDPSTPAPSTTTTL
B cell epitope (IEDB)1
T cell epitope (IEDB)16
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)21
MHC class II prediction (Propred)16
MHC class 1 prediction (Propred1)158
CTL epitope prediction (CTLpred)21
Prediction of interferon-gamma inducing peptides (IFNepitope)128
Prediction of IL4 inducing peptides (IL4pred)173