Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297730441
StrainMtb_KZN_R506
Protein IDZP_06959559.1
Description periplasmic phosphate-binding lipoprotein pstS1 [Mycobacterium tuber
Sequence MKIRLHTLLAVLTAAPLLLAAAGCGSKPPSGSPETGAGAGTVATTPASSP
VTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTV
NIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVL
AAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLS
KQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGI
SFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISM
IDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLD
QVHFQPLPPAVVKLSDALIATISS
B cell epitope (IEDB)41
T cell epitope (IEDB)183
MHC binder (IEDB)68
Vaccine TargetYes
B cell prediction (LBtope)62
MHC class II prediction (Propred)47
MHC class 1 prediction (Propred1)232
CTL epitope prediction (CTLpred)48
Prediction of interferon-gamma inducing peptides (IFNepitope)112
Prediction of IL4 inducing peptides (IL4pred)222