Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297731712
StrainMtb_KZN_R506
Protein IDZP_06960830.1
Description undecaprenyl pyrophosphate phosphatase [Mycobacterium tuberculosis K
Sequence MTAAPAMSWWQVIVLAAAQGLTEFLPVSSSGHLAIVSRIFFSGDAGASFT
AVSQLGTEAAVVIYFARDIVRILSAWLHGLVVKAHRNTDYRLGWYVIIGT
IPICILGLFFKDDIRSGVRNLWVVVTALVVFSGVIALAEYVGRQSRHIER
LTWRDAVVVGIAQTLALVPGVSRSGSTISAGLFLGLDRELAARFGFLLAI
PAVFASGLFSLPDAFHPVTEGMSATGPQLLVATLIAFVLGLTAVAWLLRF
LVRHNMYWFVGYRVLVGTGMLVLLATGTVAAT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)91
MHC class 1 prediction (Propred1)215
CTL epitope prediction (CTLpred)73
Prediction of interferon-gamma inducing peptides (IFNepitope)114
Prediction of IL4 inducing peptides (IL4pred)154