Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297731819
StrainMtb_KZN_R506
Protein IDZP_06960937.1
Description protein tyrosine phosphatase [Mycobacterium tuberculosis KZN R506]
Sequence MSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHV
GSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQL
GVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLH
DWVDERLARNGPS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)12
MHC class II prediction (Propred)20
MHC class 1 prediction (Propred1)108
CTL epitope prediction (CTLpred)25
Prediction of interferon-gamma inducing peptides (IFNepitope)62
Prediction of IL4 inducing peptides (IL4pred)111