Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297733530
StrainMtb_KZN_R506
Protein IDZP_06962648.1
Description hypothetical protein MtubKR_20665 [Mycobacterium tuberculosis KZN R5
Sequence MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSGATMAALANFFRIKAAYFTDDEYYEKLDKELQWLCTMRDDGVR
RIAQRAHGLPSAAQQKVLDRIDELRRAEGIDA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)11
MHC class II prediction (Propred)15
MHC class 1 prediction (Propred1)88
CTL epitope prediction (CTLpred)23
Prediction of interferon-gamma inducing peptides (IFNepitope)47
Prediction of IL4 inducing peptides (IL4pred)59