Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID313658819
StrainMtb_KZN_V2475
Protein IDZP_07815699.1
Description lipid hydroperoxide peroxidase [Mycobacterium tuberculosis KZN V2475
Sequence MAQITLRGNAINTVGELPAVGSPAPAFTLTGGDLGVISSDQFRGKSVLLN
IFPSVDTPVCATSVRTFDERAAASGATVLCVSKDLPFAQKRFCGAEGTEN
VMPASAFRDSFGEDYGVTIADGPMAGLLARAIVVIGADGNVAYTELVPEI
AQEPNYEAALAALGA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)7
MHC class II prediction (Propred)18
MHC class 1 prediction (Propred1)109
CTL epitope prediction (CTLpred)23
Prediction of interferon-gamma inducing peptides (IFNepitope)68
Prediction of IL4 inducing peptides (IL4pred)83