Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID313658854
StrainMtb_KZN_V2475
Protein IDZP_07815734.1
Description hypothetical protein MtubKV_10556 [Mycobacterium tuberculosis KZN V2
Sequence MVIVADKAAGRVADPVLRPVGALGDFFAMTLDTSVCMFKPPFAWREYLLQ
CWFVARVSTLPGVLMTIPWAVISGFLFNVLLTDIGAADFSGTGCAIFTVN
QSAPIVTVLVVAGAGATAMCADLGARTIREELDALRVMGINPIQALAAPR
VLAATTVSLALNSVVTATGLIGAFFCSVFLMHVSAGAWVTGLTTLTHTVD
VVISMIKATLFGLMAGLIACYKGMSVGGGPAGVGRAVNETVVFAFIVLFV
INIVVTAVGIPFMVS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)8
MHC class II prediction (Propred)68
MHC class 1 prediction (Propred1)191
CTL epitope prediction (CTLpred)64
Prediction of interferon-gamma inducing peptides (IFNepitope)125
Prediction of IL4 inducing peptides (IL4pred)197