Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID313660287
StrainMtb_KZN_V2475
Protein IDZP_07817167.1
Description hypothetical protein MtubKV_17777 [Mycobacterium tuberculosis KZN V2
Sequence MPLYAAYGSNMHPEQMLERAPHSPMAGTGWLPGWRLTFGGEDIGWEGALA
TVVEDPDSKVFVVLYDMTPADEKNLDRWEGSEFGIHQKIRCRVERISSDT
TTDPVLAWLYVLDAWEGGLPSARYLGVMADAAEIAGAPSDYVHDLRTRPA
RNIGPGTIA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)17
MHC class II prediction (Propred)22
MHC class 1 prediction (Propred1)103
CTL epitope prediction (CTLpred)20
Prediction of interferon-gamma inducing peptides (IFNepitope)86
Prediction of IL4 inducing peptides (IL4pred)115