Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID31791531
StrainM_bovis_AF2122_97
Protein IDNP_854024.1
Description HEAT shock protein transcriptional regulator HspR [Mycobacterium bovis
Sequence MAKNPKDGESRTFLISVAAELAGMHAQTLRTYDRLGLVSPRRTSGGGRRY
SLHDVELLRQVQHLSQDEGVNLAGIKRIIELTSQVEALQSRLQEMAEELA
VLRANQRREVAVVPKSTALVVWKPRR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)7
MHC class II prediction (Propred)19
MHC class 1 prediction (Propred1)87
CTL epitope prediction (CTLpred)27
Prediction of interferon-gamma inducing peptides (IFNepitope)38
Prediction of IL4 inducing peptides (IL4pred)61