Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID31791610
StrainM_bovis_AF2122_97
Protein IDNP_854103.1
Description periplasmic superoxide dismutase [Cu-Zn] SodC [Mycobacterium bovis AF21
Sequence MPKPADHRNHAAVSTSVLSALFLGAGAALLSACSSPQHASTVPGTTPSIW
TGSPAPSGLSGHDEESPGAQSLTSTLTAPDGTKVATAKFEFANGYATVTI
ATTGVGKLTPGFHGLHIHQVGKCEPNSVAPTGGAPGNFLSAGGHYHVPGH
TGTPASGDLASLQVRGDGSAMLVTTTDAFTMDDLLSGAKTAIIIHAGADN
FANIPPERYVQVNGTPGPDETTLTTGDAGKRVACGVIGSG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)12
MHC class II prediction (Propred)20
MHC class 1 prediction (Propred1)135
CTL epitope prediction (CTLpred)19
Prediction of interferon-gamma inducing peptides (IFNepitope)69
Prediction of IL4 inducing peptides (IL4pred)137