Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID31791628
StrainM_bovis_AF2122_97
Protein IDNP_854121.1
Description transmembrane transport protein MmpL4 [Mycobacterium bovis AF2122/97]
Sequence MSTKFANDSNTNARPEKPFIARMIHAFAVPIILGWLAVCVVVTVFVPSLE
AVGQERSVSLSPKDAPSFEAMGRIGMVFKEGDSDSFAMVIIEGNQPLGDA
AHKYYDGLVAQLRADKKHVQSVQDLWGDPLTAAGVQSNDGKAAYVQLSLA
GNQGTPLANESVEAVRSIVESTPAPPGIKAYVTGPSALAADMHHSGDRSM
ARITMVTVAVIFIMLLLVYRSIITVVLLLITVGVELTAARGVVAVLGHSG
AIGLTTFAVSLLTSLAIAAGTDYGIFIIGRYQEARQAGEDKEAAYYTMYR
GTAHVILGSGLTITGATFCLSFARMPYFQTLGIPCAVGMLVAVAVALTLG
PAVLHVGSRFGLFDPKRLLKVRGWRRVGTVVVRWPLPVLVATCAIALVGL
LALPGYKTSYNDRDYLPDFIPANQGYAAADRHFSQARMKPEILMIESDHD
MRNPADFLVLDKLAKGIFRVPGISRVQAITRPEGTTMDHTSIPFQISMQN
AGQLQTIKYQRDRANDMLKQADEMATTIAVLTRMHSLMAEMASTTHRMVG
DTEEMKEITEELRDHVADFDDFWRPIRSYFYWEKHCYGIPICWSFRSIFD
ALDGIDKLSEQIGVLLGDLREMDRLMPQMVAQIPPQIEAMENMRTMILTM
HSTMTGIFDQMLEMSDNATAMGKAFDAAKNDDSFYLPPEVFKNKDFQRAM
KSFLSSDGHAARFIILHRGDPQSPEGIKSIDAIRTAAEESLKGTPLEDAK
IYLAGTAAVFHDISEGAQWDLLIAAISSLCLIFIIMLIITRAFIAAAVIV
GTVALSLGASFGLSVLLWQHILAIHLHWLVLAMSVIVLLAVGSDYNLLLV
SRFKQEIGAGLKTGIIRSMGGTGKVVTNAGLVFAVTMASMAVSDLRVIGQ
VGTTIGLGLLFDTLIVRSFMTPSIAALLGRWFWWPLRVRSRPARTPTVPS
ETQPAGRPLAMSSDRLG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)74
MHC class II prediction (Propred)211
MHC class 1 prediction (Propred1)693
CTL epitope prediction (CTLpred)178
Prediction of interferon-gamma inducing peptides (IFNepitope)372
Prediction of IL4 inducing peptides (IL4pred)639