Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID31793560
StrainM_bovis_AF2122_97
Protein IDNP_856053.1
Description phenyloxazoline synthase [Mycobacterium bovis AF2122/97]
Sequence MVHATACSEIIRAEVAELLGVRADALHPGANLVGQGLDSIRMMSLVGRWR
RKGIAVDFATLAATPTIEAWSQLVSAGTGVAPTAVAAPGDAGLSQEGEPF
PLAPMQHAMWVGRHDHQQLGGVAGHLYVEFDGARVDPDRLRAAATRLALR
HPMLRVQFLPDGTQRIPPAAGSRDFPISVADLRHVAPDVVDQRLAGIRDA
KSHQQLDGAVFELALTLLPGERTRLHVDLDMQAADAMSYRILLADLAALY
DGREPPALGYTYQEYRQAIEAEETLPQPVRDADRDWWAQRIPQLPDPPAL
PTRAGGERDRRRSTRRWHWLDPQTRDALFARARARGITPAMTLAAAFANV
LARWSASSRFLLNLPLFSRQALHPDVDLLVGDFTSSLLLDVDLTGARTAA
ARAQAVQEALRSAAGHSAYPGLSVLRDLSRHRGTQVLAPVVFTSALGLGD
LFCPDVTEQFGTPGWIISQGPQVLLDAQVTEFDGGVLVNWDVREGVFAPG
VIDAMFTHQVDELLRLAAGDDAWDAPSPSALPAAQRAVRAALNGRTAAPS
TEALHDGFFRQAQQQPDAPAVFASSGDLSYAQLRDQASAVAAALRAAGLR
VGDTVAVLGPKTGEQVAAVLGILAAGGVYLPIGVDQPRDRAERILATGSV
NLALVCGPPCQVRVPVPTLLLADVLAAAPAEFVPGPSDPTALAYVLFTSG
STGEPKGVEVAHDAAMNTVETFIRHFELGAADRWLALATLECDMSVLDIF
AALRSGGAIVVVDEAQRRDPDAWARLIDTYEVTALNFMPGWLDMLLEVGG
GRLSSLRAVAVGGDWVRPDLARRLQVQAPSARFAGLGGATETAVHATIFE
VQDAANLPPDWASVPYGVPFPNNACRVVADSGDDCPDWVAGELWVSGRGI
ARGYRGRPELTAERFVEHDGRTWYRTGDLARYWHDGTLEFVGRADHRVKI
SGYRVELGEIEAALQRLPGVHAAAATVLPGGSDVLAAAVCVDDAGVTAES
IRQQLADLVPAHMIPRHVTLLDRIPFTDSGKIDRAEVGALLAAEVERSGD
RSAPYAAPRTVLQRALRRIVADILGRANDAVGVHDDFFALGGDSVLATQV
VAGIRRWLDSPSLMVADMFAARTIAALAQLLTGREANADRLELVAEVYLE
IANMTSADVMAALDPIEQPAQPAFKPWVKRFTGTDKPGAVLVFPHAGGAA
AAYRWLAKSLVANDVDTFVVQYPQRADRRSHPAADSIEALALELFEAGDW
HLTAPLTLFGHCMGAIVAFEFARLAERNGVPVRALWASSGQAPSTVAASG
PLPTADRDVLADMVDLGGTDPVLLEDEEFVELLVPAVKADYRALSGYSCP
PDVRIRANIHAVGGNRDHRISREMLTSWETHTSGRFTLSHFDGGHFYLND
HLDAVARMVSADVR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)114
MHC class II prediction (Propred)189
MHC class 1 prediction (Propred1)963
CTL epitope prediction (CTLpred)259
Prediction of interferon-gamma inducing peptides (IFNepitope)607
Prediction of IL4 inducing peptides (IL4pred)895