Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 31793919 |
| Strain | M_bovis_AF2122_97 |
| Protein ID | NP_856412.1 |
| Description | transcriptional regulatory protein [Mycobacterium bovis AF2122/97] |
| Sequence | MAALVREVVGDVLRGARMSQGRTLREVSDSARVSLGYLSEIERGRKEPSS ELLSAICTALQLPLSVVLIDAGERMARQERLARATPAGRATGATIDASTK VVIAPVVSLAVA |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 0 |
| MHC binder (IEDB) | 0 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 4 |
| MHC class II prediction (Propred) | 15 |
| MHC class 1 prediction (Propred1) | 75 |
| CTL epitope prediction (CTLpred) | 19 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 29 |
| Prediction of IL4 inducing peptides (IL4pred) | 72 |