Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID31794046
StrainM_bovis_AF2122_97
Protein IDNP_856539.1
Description transmembrane protein [Mycobacterium bovis AF2122/97]
Sequence MMFVTGIVLFALAILISVALHECGHMWVARRTGMKVRRYFVGFGPTLWST
RRGETEYGVKAVPLGGFCDIAGMTPVEELDPDERDRAMYKQATWKRVAVL
FAGPGMNLAICLVLIYAIALVWGLPNLHPPTRAVIGETGCVAQEVSQGKL
EQCTGPGPAALAGIRSGDVVVKVGDTPVSSFDEMAAAVRKSHGSVPIVVE
RDGTAIVTYVDIESTQRWIPNGQGGELQPATVGAIGVGAARVGPVRYGVF
SAMPATFAFTGDLTVEVGKALAALPTKVGALVRAIGGGQRDPQTPISVVG
ASIIGGDTVDHGLWVAFWFFLAQLNLILAAINLLPLLPFDGGHIAVAVFE
RIRNMVRSARGKVAAAPVNYLKLLPATYVVLVLVVGYMLLTVTADLVNPI
RLFQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)26
MHC class II prediction (Propred)87
MHC class 1 prediction (Propred1)288
CTL epitope prediction (CTLpred)85
Prediction of interferon-gamma inducing peptides (IFNepitope)152
Prediction of IL4 inducing peptides (IL4pred)258