Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID31794262
StrainM_bovis_AF2122_97
Protein IDNP_856755.1
Description monooxygenase [Mycobacterium bovis AF2122/97]
Sequence MNQHFDVLIIGAGLSGIGTACHVTAEFPDKTIALLERRERLGGTWDLFRY
PGVRSDSDMFTFGYKFRPWRDVKVLADGASIRQYIADTATEFGIDEKIHY
GLKVNTAEWSSRQCRWTVAGVHEATGETRTYTCDYLISCTGYYNYDAGYL
PDFPGVHRFGGRCVHPQHWPEDLDYSGKKVVVIGSGATAVTLVPAMAGSN
PGSAAHVTMLQRSPSYIFSLPAVDKISEVLGRFLPDRWVYEFGRRRNIAI
QRKLYQACRRWPKLMRRLLLWEVRRRLGRSVDMSNFTPNYLPWDERLCAV
PNGDLFKTLASGAASVVTDQIETFTEKGILCKSGREIEADIIVTATGLNI
QMLGGMRLIVDGAEYQLPEKMTYKGVLLENAPNLAWIIGYTNASWTLKSD
IAGAYLCRLLRHMADNGYTVATPRDAQDCALDVGMFDQLNSGYVKRGQDI
MPRQGSKHPWRVLMHYEKDAKILLEDPIDDGVLHFAAAAQDHAAA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)37
MHC class II prediction (Propred)86
MHC class 1 prediction (Propred1)346
CTL epitope prediction (CTLpred)89
Prediction of interferon-gamma inducing peptides (IFNepitope)147
Prediction of IL4 inducing peptides (IL4pred)354