Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID31794978
StrainM_bovis_AF2122_97
Protein IDNP_857471.1
Description secreted antigen 85-A FbpA [Mycobacterium bovis AF2122/97]
Sequence MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLP
VEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPA
FEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPG
WLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQ
AMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRV
WVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFP
DSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA
B cell epitope (IEDB)0
T cell epitope (IEDB)280
MHC binder (IEDB)73
Vaccine TargetYes
B cell prediction (LBtope)28
MHC class II prediction (Propred)44
MHC class 1 prediction (Propred1)209
CTL epitope prediction (CTLpred)36
Prediction of interferon-gamma inducing peptides (IFNepitope)192
Prediction of IL4 inducing peptides (IL4pred)205