Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339630247
StrainM_africanum_GM041182
Protein IDYP_004721889.1
Description fatty-acid-CoA ligase [Mycobacterium africanum GM041182]
Sequence MTAQLASHLTRALTLAQQQPYLARRQNWVNQLERHAMMQPDAPALRFVGN
TMTWADLRRRVAALAGALSGRGVGFGDRVMILMLNRTEFVESVLAANMIG
AIAVPLNSRLTPTEIAVLVEDCAAHVMLTEAALAPVAIGVRNIQPLLSVI
VVAGGSSQDSVFGYEDLLNEAGDVHEPVDIPNDSPALIMYTSGTTGRPKG
AVLTHANLTGQAMTALYTSGANINSDVGFVGVPLFHIAGIGNMLTGLLLG
LPTVIYPLGAFDPGQLLDVLEAEKVTGIFLVPAQWQAVCTEQQARPRDLR
LRVLSWGAAPAPDALLRQMSATFPETQILAAFGQTEMSPVTCMLLGEDAI
AKRGSVGRVIPTVAARVVDQNMNDVPVGEVGEIVYRAPTLMSCYWNNPEA
TAEAFAGGWFHSGDLVRMDSDGYVWVVDRKKDMIISGGENIYCAELENVL
ASHPDIAEVAVIGRADEKWGEVPIAVAAVTNDDLRIEDLGEFLTDRLARY
KHPKALEIVDALPRNPAGKVLKTELRLRYGACVNVERRSASAGFTERREN
RQKL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)38
MHC class II prediction (Propred)87
MHC class 1 prediction (Propred1)387
CTL epitope prediction (CTLpred)100
Prediction of interferon-gamma inducing peptides (IFNepitope)240
Prediction of IL4 inducing peptides (IL4pred)332