Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339630654
StrainM_africanum_GM041182
Protein IDYP_004722296.1
Description GntR family transcriptional regulator [Mycobacterium africanum GM04
Sequence MALQPVTRRSVPEEVFEQIATDVLTGEMPPGEALPSERRLAELLGVSRPA
VREALKRLSAAGLVEVRQGDVTTVRDFRRHAGLDLLPRLLFRNGELDISV
VRSILEARLRNFPKVAELAAERNEPELAELLQDSLRALDTEEDPIVWQRH
TLDFWDHVVDSAGSIVDRLMYNAFRAAYEPTLAALTTTMTAAAKRPSDYR
KLADAICSGDPTGAKKAAQDLLELANTSLMAVLVSQASRQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)13
MHC class II prediction (Propred)32
MHC class 1 prediction (Propred1)160
CTL epitope prediction (CTLpred)49
Prediction of interferon-gamma inducing peptides (IFNepitope)104
Prediction of IL4 inducing peptides (IL4pred)129