Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339631849
StrainM_africanum_GM041182
Protein IDYP_004723491.1
Description hypothetical protein MAF_18170 [Mycobacterium africanum GM041182]
Sequence MTAVADAPQADIEGVASPQAVVVGVMAGEGVQIGVLLDANAPVSVMTDPL
LKVVNSRLRELGEAPLEATGRGRWALCLVDGAPLRATQSLTEQDVYDGDR
LWIRFIADTERRSQVIEHISTAVASDLSKRFARIDPIVAVQVGASMVATG
VVLATGVLGWWRWHHNTWLTTIYTAVIGVLVLAVAMLLLMRAKTDADRRV
ADIMLMSAIMPVTVAAAAALPGPVGSPQAVLGFGVLTVAAALALRFTGRR
LGIYTTIVIIDALTMLAALARMVAATSAVTLLSSLLLICVVAYHAAPALS
RRLAGIRLPVFPSATSRWVFEARPDLPTTVVVSGGSAPVLEGPSSVRDVL
LQAERARSFLSGLLTGLGVMVVVCMTSLCDPHTGQRWLPLILAGFTSGFL
LLRGRSYVDRWQSITLAGTAVIIAAAVCVRYALELSSPLAVSIVAAILVL
LPAAGMAAAAHVPHTIYSPLFRKFVEWIEYLCLMPIFPLALWLMNVYAAI
RYR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)119
MHC class 1 prediction (Propred1)381
CTL epitope prediction (CTLpred)101
Prediction of interferon-gamma inducing peptides (IFNepitope)197
Prediction of IL4 inducing peptides (IL4pred)288