Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339631871
StrainM_africanum_GM041182
Protein IDYP_004723513.1
Description PE-PGRS family protein [Mycobacterium africanum GM041182]
Sequence MSFVVTIPEALAAVATDLAGIGSTIGTANAAAAVPTTTVLAAAADEVSAA
MAALFSGHAQAYQALSAQAALFHEQFVRALTAGAGSYAAAEAASAAPLEG
VLDVINAPALALLGRPLIGNGANGAPGTGANGGDGGILIGNGGAGGSGAA
GMPGGNGGAAGLFGNGGAGGAGGNVASGTAGFGGAGGAGGLLYGAGGAGG
AGGRAGGGVGGIGGAGGAGGNGGLLFGAGGAGSVGGLAADAGDGGAGGDG
GLFFGVGGAGGAGGTGTNVTGGAGGAGGNGGLLFGAGGVGGVGGDGVAFL
GTAPGGPGGAGGAGGLFGVGGAGGAGGIGLVGNGGAGGSGGSALLWGDGG
AGGAGGVGSTTGGAGGAGGNAGLLVGAGGAGGAGALGGGATGVGGAGGNG
GTAGLLFGAGGAGGAGGFGFGGAGGAGGLGGKAGLIGDGGDGGAGGNGTG
AKGGDGGAGGGAILVGNGGNGGNAGSGTPNGSAGTGGAGGLLGKNGMNGL
P
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)169
MHC class II prediction (Propred)26
MHC class 1 prediction (Propred1)211
CTL epitope prediction (CTLpred)16
Prediction of interferon-gamma inducing peptides (IFNepitope)362
Prediction of IL4 inducing peptides (IL4pred)245