Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339633857
StrainM_africanum_GM041182
Protein IDYP_004725499.1
Description hypothetical protein MAF_38790 [Mycobacterium africanum GM041182]
Sequence MASGSGLCKTTSNFIWGQLLLLGEGIPDPGDIFNTGSSLFKQISDKMGLA
IPGTNWIGQAAEAYLNQNIAQQLRAQVMGDLDKLTGNMISNQAKYVSDTR
DVLRAMKKMIDGVYKVCKGLEKIPLLGHLWSWELAIPMSGIAMAVVGGAL
LYLTIMTLMNATNLRGILGRLIEMLTTLPKFPGLPGLPSLPDIIDGLWPP
KLPDIPIPGLPDIPGLPDFKWPPTPGSPLFPDLPSFPGFPGFPSLPGFPG
LPGFPEFPAIPGFPALPGLPSIPNLFPGLPGLGDLLPGVGDLGKLPTWTE
LAALPDFLGGFAGLPSLGFGNLLSFASLPTVGQVTATMGQLQQLVAAGGG
PSQLASMGSQQAQLISSQAQQGGQQHATLVSDKKEDEEGAAAGVAEAERA
PIDAGTAASQRGQEGTVL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)74
MHC class II prediction (Propred)64
MHC class 1 prediction (Propred1)254
CTL epitope prediction (CTLpred)37
Prediction of interferon-gamma inducing peptides (IFNepitope)183
Prediction of IL4 inducing peptides (IL4pred)265