Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339633865
StrainM_africanum_GM041182
Protein IDYP_004725507.1
Description PE family-related protein [Mycobacterium africanum GM041182]
Sequence MEKMSHDPIAADIGTQVSDNALHGVTAGSTALTSVTGLVPAGADEVSAQA
ATAFTSEGIQLLASNASAQDQLHRAGEAVQDVARTYSQIDDGAAGVFA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)3
MHC class II prediction (Propred)4
MHC class 1 prediction (Propred1)56
CTL epitope prediction (CTLpred)5
Prediction of interferon-gamma inducing peptides (IFNepitope)38
Prediction of IL4 inducing peptides (IL4pred)33